CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Warm Goat Cheese Salad

Crispy-edged goat cheese toast meets peppery greens and a bright lemon-Dijon dressing—the French bistro classic that tastes fancy but takes 20 minutes. Perfect weeknight dinner or light lunch.

Total time
20 min
Servings
2
Calories
420
Protein
14g
Warm Goat Cheese Salad
elegantlightfrenchvegetariancheesecrispycreamytender

Ingredients

  • 5 oz fresh goat cheese (chèvre), divided into 2 rounds
  • 2 slices baguette or crusty bread, cut into 2 thick slices
  • 4 cups mixed greens or arugula
  • 1 whole fresh lemon, divided
  • ½ tbsp Dijon mustard
  • 1 small shallot, minced
  • ¼ cup walnuts or hazelnuts, roughly chopped

Instructions

  1. 1

    Make the dressing: whisk Dijon, minced shallot, 1 tbsp lemon juice, 3 tbsp olive oil, salt, and pepper in a small bowl until combined.

  2. 2

    Toast bread slices in a skillet over medium-high heat, 90 seconds per side, until light golden and crispy. Transfer to a plate.

  3. 3

    Place a round of goat cheese on each bread slice, then return to the skillet over medium heat.

  4. 4

    Cook 2–3 minutes until the cheese starts to soften and the bottom of the bread colors slightly. Don't move the toast.

  5. 5

    Toss greens with dressing and divide between two plates or bowls. Top each with a warm goat cheese toast.

  6. 6

    Scatter nuts over the salad. Squeeze remaining lemon wedge over everything. Serve immediately.

Tools you’ll need

  • small mixing bowl
  • whisk
  • 12-inch skillet
  • spatula
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.