Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Warm Goat Cheese Salad

Crispy-edged goat cheese toast meets peppery greens and a bright lemon-Dijon dressing—the French bistro classic that tastes fancy but takes 20 minutes. Perfect weeknight dinner or light lunch.

Total time
20 min
Servings
2
Calories
420
Protein
14g
Warm Goat Cheese Salad
elegantlightfrenchvegetariancheesecrispycreamytender

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Make the dressing: whisk Dijon, minced shallot, 1 tbsp lemon juice, 3 tbsp olive oil, salt, and pepper in a small bowl until combined.

  2. Step 2

    Toast bread slices in a skillet over medium-high heat, 90 seconds per side, until light golden and crispy. Transfer to a plate.

  3. Step 3

    Place a round of goat cheese on each bread slice, then return to the skillet over medium heat.

  4. Step 4

    Cook 2–3 minutes until the cheese starts to soften and the bottom of the bread colors slightly. Don't move the toast.

  5. Step 5

    Toss greens with dressing and divide between two plates or bowls. Top each with a warm goat cheese toast.

  6. Step 6

    Scatter nuts over the salad. Squeeze remaining lemon wedge over everything. Serve immediately.

Tools you’ll need

  • small mixing bowl
  • whisk
  • 12-inch skillet
  • spatula
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.