Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Yucatán Pork with Roasted Potatoes

Quick-seared pork shoulder cubes with warm spices, roasted potatoes, and sautéed vegetables in one sheet pan. A stripped-down weeknight take on lomitos de Valladolid that skips the long simmer.

Total time
20 min
Servings
4
Calories
420
Protein
42g
20-Min Yucatán Pork with Roasted Potatoes
comfortsatisfyingmexicanporktendercrispyweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat pork dry. Toss pork, potatoes, bell pepper, and tomatoes with oil, cumin, oregano, salt, and pepper.

  2. Step 2

    Spread in a single layer on a sheet pan. Roast at 425°F for 18–20 minutes until pork is cooked through.

  3. Step 3

    Check pork internal temp reaches 160°F. Potatoes and tomatoes should be tender with charred edges.

  4. Step 4

    Divide onto plates. Squeeze fresh lime and serve warm.

Tools you’ll need

  • sheet pan (18x13 inch)
  • oven
  • instant-read meat thermometer
  • chef's knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.