Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sheet-Pan Mole Amarillo Chicken Empanadas

Crispy, golden empanada wrappers stuffed with shredded rotisserie chicken and earthy yellow mole sauce, finished on a sheet pan in 25 minutes. One-pan, zero-fuss weeknight dinner that tastes like a taquería.

Total time
25 min
Servings
4
Calories
445
Protein
24g
Sheet-Pan Mole Amarillo Chicken Empanadas
comfortsatisfyingmexicanchickencrispyflakytenderweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Toss shredded chicken with mole paste and diced poblano until coated; stir in cilantro and queso fresco.

  2. Step 2

    Place 2 tbsp filling on each empanada disc, fold in half, and crimp edges with a fork to seal.

  3. Step 3

    Beat egg with 1 tbsp water. Brush both sides of each empanada with egg wash.

  4. Step 4

    Arrange empanadas on a sheet pan lined with parchment, drizzle with olive oil, and bake at 400°F for 18–20 minutes until deep golden.

  5. Step 5

    Let cool 2 minutes, then serve hot with extra mole on the side if desired.

Tools you’ll need

  • sheet pan
  • parchment paper
  • small bowl
  • fork
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.