Custrd is out on the App Store — Download it free →
Back to recipes

Overnight Mayo-Mustard Crispy Chicken Tenders

Chicken tenders marinated overnight in a tangy mayo-mustard blend, then coated in homemade herb breadcrumbs and pan-fried in a cast iron skillet until deeply golden and juicy inside. The overnight soak is the secret to unbeatable tenderness and flavor in every bite.

Total time
25 min
Servings
2
Calories
480
Protein
42g
Overnight Mayo-Mustard Crispy Chicken Tenders
AmericanHigh-Proteinamericanchickenfriedcrsipycast ironweeknight

Ingredients

15 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    In a medium bowl, whisk together the mayonnaise, dijon mustard, garlic powder, onion powder, black pepper, and sea salt until fully combined into a smooth, uniform marinade — no streaks of mayo should remain.

  2. Step 2

    Pat the chicken tenderloins completely dry with paper towels before adding them to the bowl. Surface moisture is the enemy of crust adhesion. Toss the dried tenders in the marinade until every piece is thoroughly coated on all sides. Cover tightly with plastic wrap and refrigerate overnight, or for a minimum of 4 hours.

  3. Step 3

    Tear the bread slices into rough chunks and pulse in a food processor until you have coarse, uneven crumbs — pulse 6 to 8 times rather than running the processor continuously, which would produce fine dust instead of the chunky crumbs that create a craggy, textured crust.

  4. Step 4

    Spread the crumbs on a sheet tray in a single layer and toast in a 350°F oven for 5 to 7 minutes, stirring once halfway, until just barely golden and completely dry to the touch. Transfer to a shallow bowl and let cool for 2 minutes.

  5. Step 5

    Add the garlic powder, onion powder, salt, paprika, dill, and basil to the toasted crumbs. Toss thoroughly with your fingers, rubbing the seasonings into the crumbs so the flavor is distributed evenly throughout and not sitting in a pocket at the bottom of the bowl.

  6. Step 6

    Remove the marinated chicken from the fridge 10 minutes before cooking — cold chicken straight from the fridge drops the oil temperature when it hits the pan, which causes the crust to absorb oil and turn greasy rather than sear. Heat the avocado oil in the cast iron skillet over medium heat for 2 to 3 minutes until shimmering. Drop a single breadcrumb in — if it sizzles immediately, the oil is ready.

  7. Step 7

    Pull each tender out of the marinade without wiping it clean — the mayo coating still on the surface is your binder. Press each piece firmly into the herbed breadcrumbs on both sides, using the palm of your hand to press the crumbs in so they clump and adhere rather than just dusting the surface.

  8. Step 8

    Lay the breaded tenders in the hot skillet in a single layer without touching. If they don't all fit, fry in two batches rather than crowding. Cook completely undisturbed for 3 to 4 minutes until a deep golden crust has formed on the bottom — resist the urge to peek or move them, which breaks the crust before it sets.

  9. Step 9

    Flip each tender once with tongs and cook for another 3 to 4 minutes until the second side matches the first. Check doneness with an instant-read thermometer inserted into the thickest tender — the internal temperature must reach 165°F. Transfer to the wire rack over the sheet tray immediately (not paper towels, which trap steam and soften the crust). Season with a small pinch of salt while still hot.

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.