Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Min Pancit Bihon

Stir-fried rice noodles with chicken, shrimp, and vegetables finished with soy sauce and calamansi. A Filipino weeknight staple that hits the table in under 15 minutes.

Total time
15 min
Servings
4
Calories
385
Protein
28g
15-Min Pancit Bihon
comfortcasualfilipinochickenshrimptenderchewyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pour boiling water over rice noodles in a bowl and let sit 5 minutes until pliable. Drain and set aside.

  2. Step 2

    Heat 2 tbsp oil in a large skillet over medium-high heat until shimmering, about 1 minute.

  3. Step 3

    Add diced chicken, cook stirring often, until no pink remains, about 4 minutes.

  4. Step 4

    Toss in shrimp, carrots, and cabbage. Cook stirring, until shrimp turns opaque, about 3 minutes.

  5. Step 5

    Add drained noodles and soy sauce. Toss everything together for 1–2 minutes until heated through.

  6. Step 6

    Squeeze calamansi or lemon over top. Serve hot from the skillet.

Tools you’ll need

  • large skillet (12-inch)
  • bowl
  • wooden spoon or silicone spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.