Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Pancit Guisado

A savory Filipino stir-fried noodle dish with tender chicken, shrimp, and vegetables tossed in a light soy-based sauce. Ready in under 25 minutes, cooked entirely in one pan.

Total time
25 min
Servings
4
Calories
520
Protein
38g
Pancit Guisado
comfortsatisfyingfilipinochickenshrimptenderchewyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut the chicken breast into 1/4-inch-thick strips by slicing across the width of the meat, perpendicular to the length. This makes the chicken cook faster.

  2. Step 2

    Mince the garlic cloves until the pieces are smaller than a grain of rice — about the size of pencil-tip dots.

  3. Step 3

    Bring a large pot of water to a boil, then add the noodles and cook, stirring occasionally, until soft enough to bite through but still slightly firm, about 4–5 minutes.

  4. Step 4

    Drain the noodles in a colander and set aside.

  5. Step 5

    Pour 2 tablespoons of oil into a 14-inch wok or large skillet and set the heat to medium-high until the oil shimmers and slides quickly when you tilt the pan, about 90 seconds.

  6. Step 6

    Add the minced garlic to the hot oil and stir constantly for 30 seconds until the kitchen smells strongly fragrant.

  7. Step 7

    Add the chicken strips to the pan and stir continuously, breaking up any pieces, until the surface is no longer pink, about 4–5 minutes.

  8. Step 8

    Add the shrimp to the pan and stir constantly until they turn opaque and curl slightly, about 2–3 minutes.

  9. Step 9

    Pour the cooked noodles into the pan and toss everything together with two wooden spoons or spatulas until combined, about 1 minute.

  10. Step 10

    Add the shredded cabbage to the pan and stir continuously until it begins to soften and wilt, about 2 minutes.

  11. Step 11

    Pour in 3 tablespoons of soy sauce and stir everything together for 1–2 minutes until the noodles are evenly coated and the vegetables are tender.

Tools you’ll need

  • large pot
  • colander
  • 14-inch wok or large skillet
  • wooden spoon or spatula
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.