Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

10-Min Pineapple Fried Rice

Cooked rice tossed with fresh pineapple, soy sauce, and cashews in a hot skillet — crispy, sweet, and ready in 10 minutes. A vegetarian Thai-style bowl that tastes like takeout.

Total time
10 min
Servings
2
Calories
358
Protein
7g
10-Min Pineapple Fried Rice
freshquickthaivegetarianvegancrispytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a 12-inch skillet over medium-high heat until it shimmers, about 90 seconds.

  2. Step 2

    Add the chilled rice, breaking up clumps with a wooden spoon. Toss constantly for 2 minutes until the rice is heated through.

  3. Step 3

    Pour in soy sauce and toss to coat evenly. Add pineapple chunks and cashews, stirring for 1 minute until fragrant.

  4. Step 4

    Fold in green onions and remove from heat. Serve immediately while hot.

Tools you’ll need

  • 12-inch skillet
  • wooden spoon
  • cutting board
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.