Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

10-Min Pineapple Fried Rice with Tomatoes

Crispy jasmine rice tossed with sweet pineapple, tomatoes, and a salty-savory sauce. Ready in one pan and totally vegan.

Total time
10 min
Servings
2
Calories
385
Protein
6g
10-Min Pineapple Fried Rice with Tomatoes
freshquickthaiveganvegetariancrispytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  2. Step 2

    Add garlic and cook for 30 seconds until fragrant, stirring constantly.

  3. Step 3

    Add rice, breaking up any clumps, and stir-fry for 3 minutes until edges start to crisp.

  4. Step 4

    Add pineapple chunks and soy sauce, toss for 2 minutes until pineapple softens slightly.

  5. Step 5

    Divide rice into two bowls and top each with sliced tomato wedges.

  6. Step 6

    Serve immediately while the rice is still warm and crispy.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.