Back to recipes
15-Min Creamy Penne
Penne, marinara, and cream cheese come together in an Instant Pot for a silky, rich pasta that tastes like you simmered it for hours. Ready in under 5 minutes of pressure cooking.
- Total time
- 15 min
- Servings
- 4
- Calories
- 520
- Protein
- 18g
comfortitalianvegetariancreamytenderweeknightpastadinner
Ingredients
3 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Add penne, marinara sauce, and 1 cup water to the Instant Pot.
Step 2
Seal the lid and set to high pressure for 4 minutes.
Step 3
Quick-release the pressure, then stir in the cream cheese until smooth.
Step 4
Season with salt and pepper to taste, then serve hot.
Tools you’ll need
- Instant Pot (6-quart or larger)
- wooden spoon
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
