5-Min Creamy Tortellini Alfredo
Boil tortellini, toss with jarred Alfredo sauce, and finish with fresh Parmesan. Rich, silky, and done in under 5 minutes—the weeknight pasta that actually works.
- Total time
- 5 min
- Servings
- 2
- Calories
- 620
- Protein
- 28g

comfortquickitalianvegetariancreamytenderweeknightpasta
Ingredients
- 1 lb fresh or frozen tortellini
- 1.5 cups Alfredo sauce
- ½ cup Parmesan cheese, grated
Instructions
- 1
Boil salted water in a large pot over high heat, then add tortellini.
- 2
Cook until tortellini floats and edges are tender, about 3 minutes for fresh or 4 for frozen.
- 3
Drain tortellini, reserving 1/4 cup pasta water, then return to the pot.
- 4
Pour Alfredo sauce over tortellini and stir over low heat until coated, thinning with pasta water if needed.
- 5
Stir in half the Parmesan, then divide between bowls and top with remaining cheese.
Tools you’ll need
- large pot
- wooden spoon
- colander
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



