CookSnap is in beta — Get it free on TestFlight →
Back to recipes

5-Min Creamy Tortellini Alfredo

Boil tortellini, toss with jarred Alfredo sauce, and finish with fresh Parmesan. Rich, silky, and done in under 5 minutes—the weeknight pasta that actually works.

Total time
5 min
Servings
2
Calories
620
Protein
28g
5-Min Creamy Tortellini Alfredo
comfortquickitalianvegetariancreamytenderweeknightpasta

Ingredients

  • 1 lb fresh or frozen tortellini
  • 1.5 cups Alfredo sauce
  • ½ cup Parmesan cheese, grated

Instructions

  1. 1

    Boil salted water in a large pot over high heat, then add tortellini.

  2. 2

    Cook until tortellini floats and edges are tender, about 3 minutes for fresh or 4 for frozen.

  3. 3

    Drain tortellini, reserving 1/4 cup pasta water, then return to the pot.

  4. 4

    Pour Alfredo sauce over tortellini and stir over low heat until coated, thinning with pasta water if needed.

  5. 5

    Stir in half the Parmesan, then divide between bowls and top with remaining cheese.

Tools you’ll need

  • large pot
  • wooden spoon
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.