Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

5-Min Creamy Tortellini Alfredo

Boil tortellini, toss with jarred Alfredo sauce, and finish with fresh Parmesan. Rich, silky, and done in under 5 minutes—the weeknight pasta that actually works.

Total time
5 min
Servings
2
Calories
620
Protein
28g
5-Min Creamy Tortellini Alfredo
comfortquickitalianvegetariancreamytenderweeknightpasta

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil salted water in a large pot over high heat, then add tortellini.

  2. Step 2

    Cook until tortellini floats and edges are tender, about 3 minutes for fresh or 4 for frozen.

  3. Step 3

    Drain tortellini, reserving 1/4 cup pasta water, then return to the pot.

  4. Step 4

    Pour Alfredo sauce over tortellini and stir over low heat until coated, thinning with pasta water if needed.

  5. Step 5

    Stir in half the Parmesan, then divide between bowls and top with remaining cheese.

Tools you’ll need

  • large pot
  • wooden spoon
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.