Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crepes with Jam & Ricotta

Paper-thin crepes made in one skillet, filled with whipped ricotta and jam in under 5 minutes. The batter cooks in advance—store it in the fridge and make fresh crepes whenever hunger strikes.

Total time
25 min
Servings
2
Calories
380
Protein
12g
Crepes with Jam & Ricotta
elegantsimplefrenchvegetariancheesecreamytenderfluffy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk flour, milk, eggs, and a pinch of salt in a bowl until smooth. Let rest 5 minutes.

  2. Step 2

    Heat a 10-inch nonstick skillet over medium-high. Lightly butter it, then pour 3 tbsp batter in the center.

  3. Step 3

    Tilt and swirl the pan immediately so batter spreads thin and even. Cook 60 seconds until the bottom is pale golden.

  4. Step 4

    Flip the crepe. Cook the other side 20 seconds until set. Slide onto a plate. Repeat with remaining batter.

  5. Step 5

    Whisk ricotta with powdered sugar. Spread 2 tbsp on each crepe, add 1 tbsp jam, then fold in half.

  6. Step 6

    Serve warm or at room temperature. Dust with extra powdered sugar if you like.

Tools you’ll need

  • mixing bowl
  • whisk
  • 10-inch nonstick skillet
  • spatula
  • butter knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.