Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

5-Minute Cumin Rice

Fragrant basmati rice tempered with toasted cumin seeds, ghee, and a pinch of salt. Ready in under 5 minutes with pre-cooked rice — the TikTok version of jeera rice that actually works on a weeknight.

Total time
5 min
Servings
2
Calories
220
Protein
4g
5-Minute Cumin Rice
simplefreshindianvegetarianvegandairy-freefluffyweeknight

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat ghee in a skillet over medium-high until shimmering, about 30 seconds.

  2. Step 2

    Add cumin seeds and toast until fragrant and slightly darkened, 60–90 seconds.

  3. Step 3

    Pour in cooked rice, breaking up any clumps with a spoon.

  4. Step 4

    Toss gently for 1 minute until rice is warmed through and coated with ghee.

  5. Step 5

    Season with salt and black pepper to taste.

  6. Step 6

    Serve immediately while hot.

Tools you’ll need

  • 10-inch skillet
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.