Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Mongolian Beef

Tender beef seared until crispy, tossed in a ginger-soy glaze with chili heat and scallion brightness. One skillet, 20 minutes, tastes like takeout.

Total time
20 min
Servings
2
Calories
420
Protein
42g
Mongolian Beef
satisfyingquickchinesebeefcrispytenderweeknightmain-dish

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp neutral oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  2. Step 2

    Working in two batches, sear the beef 90 seconds per side without stirring. Transfer to a plate.

  3. Step 3

    Pour off all but 1 tbsp oil. Add ginger and chili, cook 30 seconds until fragrant.

  4. Step 4

    Add soy sauce and brown sugar, stir until sugar dissolves and mixture bubbles, about 1 minute.

  5. Step 5

    Return beef to the skillet, toss with the glaze for 1 minute until coated and heated through.

  6. Step 6

    Remove from heat. Fold in scallions, sprinkle sesame seeds, serve immediately over rice.

Tools you’ll need

  • 12-inch skillet or wok
  • cutting board
  • sharp knife
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.