No-Bake Granola Bars
Chewy, oat-based bars that come together in minutes without an oven. Mix, press, chill, and slice—perfect for grab-and-go snacks or lunch boxes.
- Total time
- 15 min
- Servings
- 8
- Calories
- 238
- Protein
- 7g

quicksatisfyingvegetarianchewycrunchyBreakfastmeal-prepsnack
Ingredients
- 2 cups rolled oats
- ½ cup almond butter (or peanut butter)
- ⅓ cup honey
- ½ cup mini chocolate chips
- ¼ teaspoon salt
Instructions
- 1
Line an 8×8-inch square baking dish with parchment paper, leaving overhang on two sides.
- 2
Mix oats, almond butter, honey, chocolate chips, and salt in a bowl until fully combined.
- 3
Pour mixture into lined dish and press firmly and evenly with the back of a spoon or spatula.
- 4
Refrigerate until firm, about 10 minutes.
- 5
Lift out using parchment overhang and cut into 8 even bars with a sharp knife.
- 6
Store in an airtight container in the fridge for up to 5 days.
Tools you’ll need
- 8×8-inch square baking dish
- parchment paper
- mixing bowl
- spoon or spatula for mixing
- spoon or spatula for pressing
- sharp knife
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



