CookSnap is in beta — Get it free on TestFlight →
Back to recipes

No-Bake Granola Bars

Chewy, oat-based bars that come together in minutes without an oven. Mix, press, chill, and slice—perfect for grab-and-go snacks or lunch boxes.

Total time
15 min
Servings
8
Calories
238
Protein
7g
No-Bake Granola Bars
quicksatisfyingvegetarianchewycrunchyBreakfastmeal-prepsnack

Ingredients

  • 2 cups rolled oats
  • ½ cup almond butter (or peanut butter)
  • ⅓ cup honey
  • ½ cup mini chocolate chips
  • ¼ teaspoon salt

Instructions

  1. 1

    Line an 8×8-inch square baking dish with parchment paper, leaving overhang on two sides.

  2. 2

    Mix oats, almond butter, honey, chocolate chips, and salt in a bowl until fully combined.

  3. 3

    Pour mixture into lined dish and press firmly and evenly with the back of a spoon or spatula.

  4. 4

    Refrigerate until firm, about 10 minutes.

  5. 5

    Lift out using parchment overhang and cut into 8 even bars with a sharp knife.

  6. 6

    Store in an airtight container in the fridge for up to 5 days.

Tools you’ll need

  • 8×8-inch square baking dish
  • parchment paper
  • mixing bowl
  • spoon or spatula for mixing
  • spoon or spatula for pressing
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.