Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

No-Bake Granola Bars

Chewy, oat-based bars that come together in minutes without an oven. Mix, press, chill, and slice—perfect for grab-and-go snacks or lunch boxes.

Total time
15 min
Servings
8
Calories
238
Protein
7g
No-Bake Granola Bars
quicksatisfyingvegetarianchewycrunchyBreakfastmeal-prepsnack

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Line an 8×8-inch square baking dish with parchment paper, leaving overhang on two sides.

  2. Step 2

    Mix oats, almond butter, honey, chocolate chips, and salt in a bowl until fully combined.

  3. Step 3

    Pour mixture into lined dish and press firmly and evenly with the back of a spoon or spatula.

  4. Step 4

    Refrigerate until firm, about 10 minutes.

  5. Step 5

    Lift out using parchment overhang and cut into 8 even bars with a sharp knife.

  6. Step 6

    Store in an airtight container in the fridge for up to 5 days.

Tools you’ll need

  • 8×8-inch square baking dish
  • parchment paper
  • mixing bowl
  • spoon or spatula for mixing
  • spoon or spatula for pressing
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.