CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Spiced Gram Flour Flatbread

Crispy-outside, tender missi roti made from gram flour, caramelized onions, and warm spices. Ready in 20 minutes with a skillet and no yeast.

Total time
20 min
Servings
2
Calories
185
Protein
7g
Spiced Gram Flour Flatbread
comfortwholesomeindianvegetarianveganchickpeascrispytender

Ingredients

  • 1 cup gram flour (besan)
  • 1 medium yellow onion, finely diced
  • 1 whole green chili, minced
  • ½ tsp cumin seeds
  • ½ cup water
  • ¼ cup fresh cilantro, chopped

Instructions

  1. 1

    Mix gram flour, onion, green chili, cumin seeds, and cilantro in a bowl.

  2. 2

    Add water slowly, stirring until a thick but pourable batter forms.

  3. 3

    Heat oil in a skillet over medium-high until it shimmers, about 90 seconds.

  4. 4

    Pour 0.25 cup batter onto the skillet and spread into a 6-inch round with the back of a spoon.

  5. 5

    Cook 3–4 minutes until the bottom is golden and edges curl away from the pan.

  6. 6

    Flip and cook the other side 2–3 minutes until lightly crispy. Serve hot.

Tools you’ll need

  • mixing bowl
  • 12-inch non-stick skillet
  • spoon or rubber spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.