Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Spiced Gram Flour Flatbread

Crispy-outside, tender missi roti made from gram flour, caramelized onions, and warm spices. Ready in 20 minutes with a skillet and no yeast.

Total time
20 min
Servings
2
Calories
185
Protein
7g
Spiced Gram Flour Flatbread
comfortwholesomeindianvegetarianveganchickpeascrispytender

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix gram flour, onion, green chili, cumin seeds, and cilantro in a bowl.

  2. Step 2

    Add water slowly, stirring until a thick but pourable batter forms.

  3. Step 3

    Heat oil in a skillet over medium-high until it shimmers, about 90 seconds.

  4. Step 4

    Pour 0.25 cup batter onto the skillet and spread into a 6-inch round with the back of a spoon.

  5. Step 5

    Cook 3–4 minutes until the bottom is golden and edges curl away from the pan.

  6. Step 6

    Flip and cook the other side 2–3 minutes until lightly crispy. Serve hot.

Tools you’ll need

  • mixing bowl
  • 12-inch non-stick skillet
  • spoon or rubber spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.