Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Missi Roti — Spiced Gram Flour Flatbread

Nutty gram flour flatbread studded with fresh herbs and warming spices, pan-fried until golden and crispy. A TikTok-friendly Indian staple that's ready in 20 minutes — no yeast, no standing time.

Total time
20 min
Servings
2
Calories
280
Protein
9g
Crispy Missi Roti — Spiced Gram Flour Flatbread
casualwholesomeindianvegetarianveganvegancrispyflaky

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix gram flour, onion, cilantro, mint, green chili, cumin, turmeric, and 1 tsp salt in a bowl.

  2. Step 2

    Add water slowly, stirring until a thick, workable dough forms — no lumps, not too wet.

  3. Step 3

    Divide dough into 4 equal balls. On an oiled surface, flatten each into a thin disc, ~7 inches across.

  4. Step 4

    Heat 1.5 tbsp oil in a 10-inch skillet over medium-high until it shimmers, about 90 seconds.

  5. Step 5

    Slide one roti onto the skillet and cook for 3–4 minutes until the bottom is deep golden and crispy.

  6. Step 6

    Flip, cook the other side another 2–3 minutes until edges curl slightly and it snaps when bent. Transfer to a plate.

Tools you’ll need

  • medium mixing bowl
  • 10-inch cast iron or nonstick skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.