Custrd is out on the App Store — Download it free →
Back to recipes

Alsatian Bacon and Onion Tart

A thin, crispy tart topped with smoky bacon, sweet onions, and a creamy custard—perfect for a quick weeknight dinner or appetizer.

Total time
35 min
Servings
4
Calories
420
Protein
14g
Alsatian Bacon and Onion Tart
comfortingFrenchporkcrispycreamyweeknighttartdinner

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 475°F. Roll out pizza dough on a floured surface into a thin rectangle, about 1/8-inch thick.

  2. Step 2

    Transfer dough to a baking sheet lined with parchment. Prick all over with a fork.

  3. Step 3

    Cook bacon in a skillet over medium until crisp, about 5 minutes. Remove and crumble; reserve 1 tbsp fat.

  4. Step 4

    Slice onion thinly. Sauté in reserved bacon fat over medium until soft and golden, about 8 minutes.

  5. Step 5

    Whisk crème fraîche, egg, nutmeg, salt, and pepper in a bowl until smooth.

  6. Step 6

    Spread cream mixture over dough, leaving a 1/2-inch border. Scatter onions and bacon on top.

  7. Step 7

    Bake until crust is golden and edges are crispy, 12–15 minutes. Slice and serve warm.

Tools you’ll need

  • rolling pin
  • baking sheet
  • parchment paper
  • skillet
  • mixing bowl
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.