Back to recipes
Apricot and Tahini Toast
A quick, satisfying toast topped with creamy tahini, sweet apricot slices, and a hint of lemon zest.
- Total time
- 10 min
- Servings
- 1
- Calories
- 320
- Protein
- 9g
quickeasymiddle-easternveganvegetarianplant-basedcrunchycreamy
Ingredients
5 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Toast the 2 slices of bread until golden and crisp, about 3-4 minutes.
Step 2
Spread 1 tablespoon of tahini on each slice of toast while still warm.
Step 3
Slice the apricot into thin wedges and arrange them over the tahini.
Step 4
Sprinkle with the 1 teaspoon sesame seeds and 0.5 teaspoon lemon zest.
Step 5
Serve immediately, warm.
Tools you’ll need
- toaster
- knife
- cutting board
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
