Back to recipes
Apricot and Tahini Toast
A quick, satisfying toast topped with creamy tahini, sweet apricot slices, and a hint of lemon zest.
- Total time
- 10 min
- Servings
- 1
- Calories
- 320
- Protein
- 9g
quickeasymiddle-easternveganvegetarianplant-basedcrunchycreamy
Ingredients
5 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Toast the 2 slices of bread until golden and crisp, about 3-4 minutes.
Step 2
Spread 1 tablespoon of tahini on each slice of toast while still warm.
Step 3
Slice the apricot into thin wedges and arrange them over the tahini.
Step 4
Sprinkle with the 1 teaspoon sesame seeds and 0.5 teaspoon lemon zest.
Step 5
Serve immediately, warm.
Tools you’ll need
- toaster
- knife
- cutting board
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
