Custrd is out on the App Store — Download it free →
Back to recipes

Avocado and Beef Sandwich

A quick and satisfying sandwich with a crispy breaded beef patty, creamy avocado slices, and fresh lettuce. Perfect for a fast lunch or dinner.

Total time
15 min
Servings
2
Calories
550
Protein
25g
Avocado and Beef Sandwich
comfortingquickAmericanbeefcrispycreamyweeknightsandwich

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cook the 2 breaded beef patties in a skillet over medium-high heat until golden brown and cooked through, about 4 minutes per side.

  2. Step 2

    Slice the 1 avocado in half, remove the pit, and cut the flesh into thin slices.

  3. Step 3

    Spread 1 tbsp mayonnaise on each of the 4 bread slices.

  4. Step 4

    Place the cooked patties on 2 bread slices, top with avocado slices and 2 lettuce leaves each, then close with the remaining bread slices.

  5. Step 5

    Serve immediately.

Tools you’ll need

  • skillet
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.