Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

25-Min Bacon & Cheese Quiche

Crispy bacon, melted cheese, and custardy eggs baked in a pie crust until golden. Serve with a fresh green salad for a complete weeknight dinner.

Total time
25 min
Servings
4
Calories
485
Protein
18g
25-Min Bacon & Cheese Quiche
comfortelegantfrencheggscreamycrispyweeknightbrunch

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Place pie crust in a 9-inch pie dish and prick the bottom with a fork.

  2. Step 2

    Cook bacon in a skillet over medium heat until crispy, about 5 minutes. Chop into bite-size pieces.

  3. Step 3

    Whisk together eggs, cream, salt, and pepper in a bowl until smooth. Stir in bacon and cheddar.

  4. Step 4

    Pour egg mixture into the crust. Bake until the center is just set and the top is golden, about 15 minutes.

  5. Step 5

    Toss mixed greens with a light vinaigrette while the quiche bakes.

  6. Step 6

    Let quiche rest 2 minutes, then slice. Serve alongside the salad.

Tools you’ll need

  • 9-inch pie dish
  • skillet
  • mixing bowl
  • whisk
  • oven
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.