Back to recipes
Baked Gnocchi Marinara
Pillowy gnocchi tossed with marinara and melted mozzarella, baked until the cheese bubbles and the edges crisp up. This is comfort food in under 20 minutes.
- Total time
- 18 min
- Servings
- 3
- Calories
- 420
- Protein
- 15g
comfortitalianvegetariancreamycrispyweeknightpastabake
Ingredients
3 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Boil gnocchi in salted water until they float, then boil 1 minute more; drain well.
Step 2
Toss warm gnocchi with marinara sauce in a bowl, then spread into a baking dish.
Step 3
Scatter mozzarella evenly over the gnocchi and sauce.
Step 4
Bake at 425°F until cheese bubbles and edges brown, 8–10 minutes.
Tools you’ll need
- pot
- colander
- 8x8-inch or 9-inch baking dish
- oven
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
