Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Balsamic Pasta Salad with Cherry Tomatoes & Basil

A bright, no-cook salad of peppery arugula, sweet cherry tomatoes, and creamy mozzarella tossed with warm pasta in a punchy balsamic vinaigrette. Ready in 20 minutes.

Total time
20 min
Servings
4
Calories
385
Protein
14g
Balsamic Pasta Salad with Cherry Tomatoes & Basil
freshlightsimpleitalianvegetariancheesetendercreamy

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring a large pot of salted water to a rolling boil over high heat — the water should bubble vigorously and steam should rise from the surface, about 8 minutes.

  2. Step 2

    Add the pasta and stir it once with a wooden spoon to separate the strands; boil until the pasta is tender but still slightly firm when bitten, about 9 minutes or according to package directions.

  3. Step 3

    Drain the pasta in a colander, then immediately rinse it under cool running water for 15 seconds while tossing with a fork to stop it cooking and cool it down.

  4. Step 4

    Place each cherry tomato on a cutting board and slice it in half straight down through the middle from top to bottom — you should have two halves per tomato.

  5. Step 5

    Stack the fresh basil leaves on top of each other, then roll them tightly into a thin cylinder; slice straight across the roll into ribbon-thin strips about the width of a pencil lead.

  6. Step 6

    Pour the balsamic vinegar and olive oil into a small bowl; whisk them together with a fork for 10 seconds until the mixture looks slightly creamy and uniform, then add a pinch of salt and pepper.

  7. Step 7

    Transfer the cooled pasta to a large bowl, then pour the balsamic dressing over it and toss everything together with two forks for 20 seconds until the pasta is evenly coated.

  8. Step 8

    Add the arugula, cherry tomato halves, and mozzarella balls to the pasta, then toss everything together gently for 15 seconds until the leaves are mixed in — do not overmix or the arugula will bruise.

  9. Step 9

    Top the salad with the basil ribbons, scatter them across the surface, and taste a forkful; add another pinch of salt and pepper if you like.

Tools you’ll need

  • large pot
  • colander
  • cutting board
  • chef's knife
  • small bowl
  • fork
  • large bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.