Back to recipes
20-Minute Feta & Cucumber Pasta
A cold pasta salad with briny olives, creamy feta, and crisp cucumber—no cooking skills required, just boil and toss. Ready in under 20 minutes and tastes better the next day.
- Total time
- 20 min
- Servings
- 4
- Calories
- 385
- Protein
- 12g
freshlightsimplegreekvegetariancheesecreamycrispy
Ingredients
6 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Boil salted water and cook rotini until al dente, about 10 minutes.
Step 2
Drain pasta and rinse under cold water until completely cool.
Step 3
Toss cooled pasta with feta, olives, cucumber, olive oil, salt, and pepper.
Step 4
Serve immediately or chill until ready.
Tools you’ll need
- large pot
- colander
- large bowl
- spoon
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
