Back to recipes
20-Minute Feta & Cucumber Pasta
A cold pasta salad with briny olives, creamy feta, and crisp cucumber—no cooking skills required, just boil and toss. Ready in under 20 minutes and tastes better the next day.
- Total time
- 20 min
- Servings
- 4
- Calories
- 385
- Protein
- 12g
freshlightsimplegreekvegetariancheesecreamycrispy
Ingredients
6 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Boil salted water and cook rotini until al dente, about 10 minutes.
Step 2
Drain pasta and rinse under cold water until completely cool.
Step 3
Toss cooled pasta with feta, olives, cucumber, olive oil, salt, and pepper.
Step 4
Serve immediately or chill until ready.
Tools you’ll need
- large pot
- colander
- large bowl
- spoon
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
