Custrd is out on the App Store — Download it free →
Back to recipes

Bangsilog

A hearty Filipino-style breakfast plate with garlic fried rice, a fried egg, and fresh tomato and lettuce. This version keeps it simple and quick for a satisfying meal any time of day.

Total time
25 min
Servings
2
Calories
450
Protein
12g
Bangsilog
comfortingheartyFilipinovegetarianeggcrispytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mince the 4 garlic cloves. Slice the 1 tomato into rounds and set aside with the 2 lettuce leaves.

  2. Step 2

    Heat 2 tbsp of the vegetable oil in a large skillet over medium heat. Add the minced garlic and cook until fragrant and lightly golden, about 1 minute.

  3. Step 3

    Add the 3 cups cooked rice to the skillet. Spread it out and press down lightly. Cook undisturbed for 2-3 minutes to get a slight crust, then stir and season with the 0.5 tsp salt. Continue frying, stirring occasionally, until the rice is hot and slightly crispy, about 5 minutes total. Remove from skillet and set aside.

  4. Step 4

    In the same skillet, add the remaining 1 tbsp vegetable oil over medium heat. Crack the 2 eggs into the pan, keeping them separate. Cook until the whites are set but yolks are still runny, about 2-3 minutes.

  5. Step 5

    Plate the garlic rice, top with the fried eggs, and serve with the tomato slices and lettuce on the side. Season with extra salt if desired.

Tools you’ll need

  • Large skillet
  • Knife
  • Cutting board
  • Spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.