Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

25-Min Beef Satay with Peanut Sauce

Tender marinated beef grilled until charred, served with a silky peanut sauce and crisp vegetable sides. One skillet, under 15 minutes active time.

Total time
25 min
Servings
2
Calories
485
Protein
38g
25-Min Beef Satay with Peanut Sauce
satisfyingfreshmalaysianbeeftendercharredcreamyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Thread beef cubes onto metal or wooden skewers (soak wood 10 min first). Pat dry with paper towels.

  2. Step 2

    Whisk soy sauce, brown sugar, and minced garlic in a small bowl. Brush all over the skewered beef.

  3. Step 3

    Heat a cast iron skillet or grill pan over medium-high until smoking. Sear skewers 90 seconds per side until edges char.

  4. Step 4

    Whisk peanut butter with 3 tbsp warm water and half the lime juice until pourable. Season with salt and a pinch of cayenne.

  5. Step 5

    Arrange skewers on a plate with cucumber and tomato slices. Drizzle peanut sauce over the beef. Squeeze remaining lime on top.

Tools you’ll need

  • metal or wooden skewers (4–6 pieces)
  • 12-inch cast iron skillet or grill pan
  • small mixing bowl
  • whisk
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.