Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Belgian Mattentaart (Matzentaart)

A classic Belgian custard tart with a crispy pastry shell and silky vanilla custard filling. Baked until golden and served warm or at room temperature for a simple, elegant dessert.

Total time
50 min
Servings
8
Calories
285
Protein
5g
Belgian Mattentaart (Matzentaart)
elegantindulgentbelgianvegetariancreamycrispyflakyweekend

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Set the oven to 400°F and wait until it finishes heating, about 10 minutes.

  2. Step 2

    Remove the pastry from the fridge and fit it into a 9-inch tart pan or pie dish, pressing gently into the corners and up the sides until it covers the bottom and edges completely.

  3. Step 3

    Prick the pastry all over with a fork to prevent it from puffing up unevenly, making 8–10 small holes across the entire surface.

  4. Step 4

    Pour 1.5 cups of milk into a small saucepan and set it over medium heat until steam rises from the surface and small bubbles appear at the edges, about 3–4 minutes.

  5. Step 5

    In a medium bowl, whisk together the 4 egg yolks and 0.33 cup sugar until the mixture turns pale yellow and thick, about 2 minutes of continuous whisking.

  6. Step 6

    Sprinkle the 2 tablespoons of cornstarch over the egg mixture and whisk until no lumps remain and the mixture looks smooth and uniform.

  7. Step 7

    Slowly pour the hot milk into the egg mixture while whisking constantly to avoid scrambling the eggs—this should take about 1 minute of continuous pouring and whisking.

  8. Step 8

    Pour the combined mixture back into the saucepan and set it over medium heat, whisking constantly until it thickens into a custard the consistency of thick pudding, about 3–5 minutes.

  9. Step 9

    Remove from heat and stir in the 1 teaspoon of vanilla extract and the optional cinnamon until fully blended.

  10. Step 10

    Pour the warm custard into the pastry-lined pan and spread it evenly with a rubber spatula until it reaches the rim, creating a smooth, level surface.

  11. Step 11

    Place the tart in the preheated oven and bake until the pastry edges turn golden brown and the custard surface looks set but with a slight jiggle in the very center, about 20–25 minutes.

  12. Step 12

    Remove from the oven and let cool on a wire rack for at least 15 minutes before slicing, allowing the custard to set completely.

Tools you’ll need

  • oven
  • 9-inch tart pan or pie dish
  • fork
  • small saucepan
  • medium mixing bowl
  • whisk
  • rubber spatula
  • wire cooling rack

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.