Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Tarte Tatin

Caramelized apples baked under a golden pastry crust, then flipped to reveal a glossy, sticky top. A French classic that looks fancy but takes just 45 minutes.

Total time
45 min
Servings
6
Calories
295
Protein
2g
Tarte Tatin
elegantindulgentfrenchvegetariancrispytenderflakydate-night

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour and salt. Cut in cold butter cubes until mixture resembles coarse sand.

  2. Step 2

    Add ice water 1 tbsp at a time, stirring until dough just comes together.

  3. Step 3

    Form dough into a disk, wrap in plastic, and refrigerate while you prep apples.

  4. Step 4

    Preheat oven to 400°F. Melt 6 tbsp butter with sugar in a 10-inch ovenproof skillet over medium heat.

  5. Step 5

    Peel, halve, and core the apples. Arrange cut-side down in the caramel, fitting them snugly.

  6. Step 6

    Cook on stovetop without stirring until the caramel is deep amber and edges of apples begin to soften, ~12 minutes.

  7. Step 7

    Roll pastry into a thin circle slightly larger than the skillet. Lay it over apples, tuck edges down around fruit.

  8. Step 8

    Bake until pastry is golden brown, ~20 minutes. Remove and let cool for 2 minutes.

  9. Step 9

    Place a serving plate over the skillet and flip in one confident motion. Lift the skillet away.

  10. Step 10

    Serve warm with vanilla ice cream if desired.

Tools you’ll need

  • 10-inch ovenproof cast iron skillet or heavy-bottomed oven-safe skillet
  • cutting board and knife
  • pastry blender or two forks
  • rolling pin
  • instant-read thermometer (optional, for caramel color check)
  • serving plate (larger than skillet diameter)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.