Custrd is out on the App Store — Download it free →
Back to recipes

Bengali Fish Fry

Crispy pan-fried fish coated in a fragrant Bengali spice crust, ready in under 20 minutes. A weeknight dinner that tastes like restaurant food.

Total time
18 min
Servings
2
Calories
286
Protein
32g
Bengali Fish Fry
quickcasualindianfishcrispytenderweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the fish fillets completely dry with paper towels, pressing gently on both sides — this ensures they crisp instead of steam when fried.

  2. Step 2

    Rub each fillet on both sides with the turmeric powder, red chili powder, cumin seeds, lemon juice, salt, and pepper until evenly coated.

  3. Step 3

    Heat 3 tablespoons of oil in a 12-inch skillet over medium-high heat until it shimmers and a drop of water sizzles on contact, about 2 minutes.

  4. Step 4

    Slide the fish fillets into the hot oil, skin-side up, and cook without moving them for 4 minutes until the bottom is golden brown and crispy.

  5. Step 5

    Flip each fillet carefully with a thin spatula and cook the skin side for 2–3 minutes until the skin is deep golden and the flesh is opaque throughout.

  6. Step 6

    Transfer the fish to a serving plate lined with paper towels to drain excess oil.

Tools you’ll need

  • 12-inch skillet
  • paper towels
  • small bowl (for mixing spices)
  • thin metal spatula
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.