Custrd is out on the App Store — Download it free →
Back to recipes

Breaded Chicken with Fries

Crispy breaded chicken cutlets served with golden french fries and a zesty green sauce. A quick and satisfying meal that's perfect for any night of the week.

Total time
25 min
Servings
4
Calories
650
Protein
35g
Breaded Chicken with Fries
comfort foodweeknightamericanchickencrispytendercasual dinnermain course

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F. Spread the 4 cups frozen fries on a baking sheet and bake until golden and crispy, about 20 minutes, shaking halfway.

  2. Step 2

    While fries bake, slice 2 large chicken breasts horizontally into thin cutlets. Beat 2 eggs in a shallow dish and place 1 cup breadcrumbs on a plate.

  3. Step 3

    Dip each cutlet in egg, then press into breadcrumbs to coat evenly. Heat a large skillet over medium-high with a thin layer of oil.

  4. Step 4

    Cook the breaded chicken in batches until golden brown and cooked through, about 3-4 minutes per side. The chicken should feel firm and juices run clear.

  5. Step 5

    In a small bowl, mix 0.5 cup mayonnaise with 0.25 cup chopped parsley and a squeeze of lemon if you have it. Serve chicken and fries with the green sauce on the side.

Tools you’ll need

  • baking sheet
  • large skillet
  • shallow dish
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.