Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Breaded Chicken Tenders

Crispy pan-fried chicken tenders with a simple flour, egg and breadcrumb coating — on the table in about 20 minutes.

Total time
20 min
Servings
3
Calories
430
Protein
34g
Breaded Chicken Tenders
comfort foodfamily friendlyamericandairy freechickencrispytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the 1 lb chicken tenders dry and season all over with the 1/2 tsp salt and a little pepper.

  2. Step 2

    Put 1/2 cup flour, 2 beaten eggs, and 1 cup breadcrumbs in three separate shallow dishes.

  3. Step 3

    Coat each tender in flour, then egg, then breadcrumbs, pressing so the crumbs stick well.

  4. Step 4

    Heat the 1/2 cup oil in a large skillet over medium-high until it shimmers, about 3 minutes.

  5. Step 5

    Fry the tenders in a single layer, 3-4 minutes per side, until deep golden and cooked through.

Tools you’ll need

  • large skillet
  • 3 shallow dishes
  • tongs
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.