Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Butter & Sage Pumpkin Tortelli

Tender store-bought tortelli filled with sweet pumpkin, finished in brown butter and crispy sage. Ready in 20 minutes—no homemade pasta required.

Total time
20 min
Servings
2
Calories
520
Protein
18g
Butter & Sage Pumpkin Tortelli
elegantsimpleitalianvegetarianvegetariantendercreamyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring a large pot of salted water to a boil. Add tortelli and cook until they float, then 1 minute more—about 4 minutes total.

  2. Step 2

    While tortelli cook, melt butter in a large skillet over medium heat. Add garlic and cook 30 seconds until fragrant.

  3. Step 3

    Add sage leaves to the skillet and cook until edges crisp and butter turns golden brown, about 2 minutes.

  4. Step 4

    Drain tortelli, reserving 1 cup pasta water. Transfer tortelli to the skillet with the brown butter.

  5. Step 5

    Toss gently to coat. Add a splash of pasta water if needed—sauce should be glossy, not soupy.

  6. Step 6

    Divide between bowls, top with parmesan and lemon zest. Season with salt and pepper.

Tools you’ll need

  • large pot
  • large skillet
  • wooden spoon
  • colander
  • microplane or zester

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.