Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Pumpkin Tortelli with Brown Butter

Tender store-bought tortelli filled with roasted pumpkin, topped with nutty brown butter and crispy sage. A weeknight take on the Northern Italian classic that tastes fancy but takes less than 20 minutes.

Total time
18 min
Servings
2
Calories
485
Protein
18g
20-Min Pumpkin Tortelli with Brown Butter
elegantsimpleitalianvegetarianvegetariantendercreamyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring a large pot of salted water to a boil. Add tortelli and stir once to prevent sticking.

  2. Step 2

    While water heats, melt butter in a large skillet over medium. Add sage leaves and cook until fragrant, about 1 minute.

  3. Step 3

    Continue cooking butter, swirling occasionally, until it turns golden brown with a nutty aroma, 3–4 minutes total.

  4. Step 4

    When tortelli float and hold steady for 1 minute, they're done. Reserve 1/2 cup pasta water, then drain.

  5. Step 5

    Transfer tortelli to the brown butter skillet. Toss gently and add 2 tbsp pasta water to create a silky glaze.

  6. Step 6

    Divide into bowls. Top with parmesan, lemon zest, and a crack of black pepper. Serve immediately.

Tools you’ll need

  • large pot (4+ quart)
  • large skillet (12-inch)
  • wooden spoon
  • slotted spoon
  • microplane or zester

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.