Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Caprese Pesto Panini

Crispy toasted panini layered with fresh mozzarella, ripe tomato, and vibrant basil pesto. Warm, melty, and ready in 15 minutes.

Total time
15 min
Servings
2
Calories
520
Protein
18g
Caprese Pesto Panini
simplefreshitalianvegetariancheesecrispymeltycreamy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice panini rolls horizontally. Spread 1.5 tbsp pesto on each bottom half.

  2. Step 2

    Slice mozzarella into 3 pieces per sandwich. Layer on pesto-coated bases.

  3. Step 3

    Slice tomato 1/4-inch thick. Arrange 2–3 slices on cheese, season with salt and pepper.

  4. Step 4

    Close sandwiches with top halves. Brush exterior of both sides with olive oil.

  5. Step 5

    Heat a skillet or griddle over medium-high until water drops sizzle, ~90 seconds.

  6. Step 6

    Place panini in skillet. Cook 3–4 minutes until golden brown with light char marks.

  7. Step 7

    Flip carefully. Cook the other side 2–3 minutes until golden and cheese melts.

  8. Step 8

    Transfer to a cutting board. Cool 1 minute before serving.

Tools you’ll need

  • serrated knife
  • cutting board
  • 12-inch skillet or griddle
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.