Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Cheesy Bean Molletes

Split bolillo rolls topped with refried beans, melted cheese, and jalapeños, then broiled until bubbly. A classic Mexican snack ready in 10 minutes.

Total time
10 min
Servings
2
Calories
385
Protein
14g
Cheesy Bean Molletes
casualsatisfyingmexicanvegetariancheesecrispymeltysnack

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Position broiler rack 4 inches from heat source and preheat broiler.

  2. Step 2

    Slice rolls in half lengthwise and arrange cut-side up on a broiler pan.

  3. Step 3

    Spread 3 tablespoons refried beans on each roll half in an even layer.

  4. Step 4

    Top each with 1/4 cup shredded cheese and 1 tablespoon jalapeños.

  5. Step 5

    Broil 2–3 minutes until cheese melts and surface starts to brown.

  6. Step 6

    Season with salt and pepper. Serve immediately while cheese is still hot.

Tools you’ll need

  • broiler pan or baking sheet
  • sharp serrated knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.