CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Cheesy Beef Taco Sweet Potatoes

Crispy-skinned sweet potatoes stuffed with seasoned ground beef and melted cheddar, topped with salsa verde. A complete weeknight dinner in under 25 minutes.

Total time
25 min
Servings
2
Calories
485
Protein
28g
Cheesy Beef Taco Sweet Potatoes
comfortsatisfyingamericanbeefcrispycreamytenderweeknight

Ingredients

  • 2 whole sweet potatoes, medium
  • ½ lb ground beef
  • 2 tbsp taco seasoning
  • ¾ cup cheddar cheese, shredded

Instructions

  1. 1

    Poke each sweet potato all over with a fork, then microwave on high for 10 minutes until very soft.

  2. 2

    While potatoes cook, brown ground beef in a skillet over medium-high heat, breaking it apart, until no pink remains, ~6 minutes.

  3. 3

    Stir taco seasoning and 2 tablespoons water into beef, then simmer 2 minutes until fragrant.

  4. 4

    Split each potato lengthwise, scoop out a shallow well, then divide seasoned beef between them.

  5. 5

    Top each potato with cheddar cheese, then return to microwave for 1 minute until cheese melts.

  6. 6

    Top with salsa verde and serve immediately.

Tools you’ll need

  • microwave
  • 12-inch skillet
  • wooden spoon
  • fork

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.