Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Cheesy Beef Taco Sweet Potatoes

Crispy-skinned sweet potatoes stuffed with seasoned ground beef and melted cheddar, topped with salsa verde. A complete weeknight dinner in under 25 minutes.

Total time
25 min
Servings
2
Calories
485
Protein
28g
Cheesy Beef Taco Sweet Potatoes
comfortsatisfyingamericanbeefcrispycreamytenderweeknight

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Poke each sweet potato all over with a fork, then microwave on high for 10 minutes until very soft.

  2. Step 2

    While potatoes cook, brown ground beef in a skillet over medium-high heat, breaking it apart, until no pink remains, ~6 minutes.

  3. Step 3

    Stir taco seasoning and 2 tablespoons water into beef, then simmer 2 minutes until fragrant.

  4. Step 4

    Split each potato lengthwise, scoop out a shallow well, then divide seasoned beef between them.

  5. Step 5

    Top each potato with cheddar cheese, then return to microwave for 1 minute until cheese melts.

  6. Step 6

    Top with salsa verde and serve immediately.

Tools you’ll need

  • microwave
  • 12-inch skillet
  • wooden spoon
  • fork

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.