CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Cheesy Breakfast Waffles

Crispy-edged waffles loaded with melted cheddar and cooked from a simple batter. Serve with roasted tomatoes and sour cream for a savory breakfast that feels special but takes under 20 minutes.

Total time
18 min
Servings
2
Calories
520
Protein
18g
Cheesy Breakfast Waffles
comfortsimpleamericanvegetarianeggscrispyfluffyweeknight

Ingredients

  • 1.5 cups all-purpose flour
  • 1 cup cheddar cheese, shredded
  • 2 large eggs
  • 1 cup milk
  • ½ tsp salt
  • ¼ tsp black pepper
  • 2 tbsp olive oil

Instructions

  1. 1

    Whisk together flour, cheddar, salt, and pepper in a bowl.

  2. 2

    In another bowl, whisk eggs and milk until smooth, then pour into dry ingredients.

  3. 3

    Stir until just combined—a few lumps are fine—then drizzle in oil and fold gently.

  4. 4

    Heat waffle iron and lightly oil it, then pour batter in and cook until golden and crispy, about 4 minutes.

  5. 5

    Serve waffles warm alongside roasted cherry tomatoes and sour cream.

Tools you’ll need

  • waffle iron
  • two mixing bowls
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.