Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Cheesy Breakfast Waffles

Crispy-edged waffles loaded with melted cheddar and cooked from a simple batter. Serve with roasted tomatoes and sour cream for a savory breakfast that feels special but takes under 20 minutes.

Total time
18 min
Servings
2
Calories
520
Protein
18g
Cheesy Breakfast Waffles
comfortsimpleamericanvegetarianeggscrispyfluffyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk together flour, cheddar, salt, and pepper in a bowl.

  2. Step 2

    In another bowl, whisk eggs and milk until smooth, then pour into dry ingredients.

  3. Step 3

    Stir until just combined—a few lumps are fine—then drizzle in oil and fold gently.

  4. Step 4

    Heat waffle iron and lightly oil it, then pour batter in and cook until golden and crispy, about 4 minutes.

  5. Step 5

    Serve waffles warm alongside roasted cherry tomatoes and sour cream.

Tools you’ll need

  • waffle iron
  • two mixing bowls
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.