Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Cheesy Ham Cracker Stackers

Layer crackers, cheddar, and deli ham into quick toasted stacks. Perfect grab-and-go snack that's crispy, melty, and ready in under 10 minutes.

Total time
8 min
Servings
2
Calories
185
Protein
9g
Cheesy Ham Cracker Stackers
casualquickamericancrispymeltyweeknightsnackappetizer

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 375°F and line a baking sheet with foil.

  2. Step 2

    Arrange 6 crackers on the baking sheet, then top each with a folded slice of ham.

  3. Step 3

    Divide cheese evenly among the crackers, layering it on top of the ham.

  4. Step 4

    Top each stack with a second cracker, pressing gently to hold everything together.

  5. Step 5

    Bake for 4 to 5 minutes until cheese is melted and edges are lightly golden.

  6. Step 6

    Serve hot and eat while the cheese is still gooey.

Tools you’ll need

  • baking sheet
  • foil

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.