Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Cheesy Sausage Stuffed Mushrooms

Meaty mushroom caps filled with browned sausage and cream cheese, baked until golden. Serve over rice with your favorite hot sauce on the side.

Total time
25 min
Servings
4
Calories
285
Protein
18g
Cheesy Sausage Stuffed Mushrooms
comfortamericanporktendercreamyweeknightdinnerappetizer

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Remove mushroom stems and scrape out the dark gills with a spoon, then pat caps dry.

  2. Step 2

    Brown sausage in a skillet over medium-high, breaking it up with a spoon, ~6 minutes.

  3. Step 3

    Stir cream cheese into the cooked sausage until melted and combined, ~1 minute.

  4. Step 4

    Arrange mushroom caps on a baking sheet and fill each with a spoonful of the sausage mixture.

  5. Step 5

    Bake at 400°F until mushroom caps are tender and filling is golden, ~12 minutes.

  6. Step 6

    Serve hot over white rice with red pepper sauce drizzled on top.

Tools you’ll need

  • 12-inch skillet
  • baking sheet
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.