Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Cherry Strudel

Flaky phyllo wrapped around spiced cherries with a buttery, crispy exterior. A classic Austrian dessert that tastes restaurant-quality but comes together in under an hour.

Total time
40 min
Servings
4
Calories
310
Protein
4g
Cherry Strudel
elegantcozyaustrianvegetarianflakycrispytenderweekend

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 375°F. Mix cherries, sugar, cornstarch, and cinnamon in a bowl until evenly coated.

  2. Step 2

    Lay a sheet of phyllo on a clean counter. Brush lightly with melted butter, then sprinkle with breadcrumbs.

  3. Step 3

    Layer remaining phyllo sheets, brushing each with butter and breadcrumbs between layers.

  4. Step 4

    Spread cherry filling down one long edge, leaving 2 inches bare. Roll tightly, sealing the seam with butter.

  5. Step 5

    Transfer to a parchment-lined baking sheet. Brush exterior generously with remaining melted butter.

  6. Step 6

    Bake 25–30 minutes until the exterior is deep golden brown and crispy.

  7. Step 7

    Cool 5 minutes on the pan. Dust lightly with powdered sugar if desired. Slice and serve warm.

Tools you’ll need

  • baking sheet
  • parchment paper
  • small bowl
  • pastry brush
  • knife
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.