Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sour Cherry Strudel with Pistachios

Crispy phyllo wrapped around tart sour cherries, baked until golden and topped with crushed pistachios. A 25-minute Hungarian dessert that tastes like it took hours.

Total time
25 min
Servings
4
Calories
285
Protein
4g
Sour Cherry Strudel with Pistachios
elegantindulgenthungarianvegetariancrispyflakydessertweekend

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 375°F. Mix sour cherries with cornstarch, sugar, and cinnamon in a bowl.

  2. Step 2

    Lay one phyllo sheet on a work surface. Brush lightly with melted butter. Repeat with 3 more sheets, stacking.

  3. Step 3

    Spread cherry mixture along the long edge closest to you, leaving 2 inches on the sides.

  4. Step 4

    Roll tightly away from you, tucking sides in as you go. Place seam-side down on a greased baking sheet.

  5. Step 5

    Brush top with remaining melted butter. Bake until golden and crispy, 15–18 minutes.

  6. Step 6

    Cool 5 minutes, then slice and top generously with crushed pistachios. Serve warm.

Tools you’ll need

  • 9x13-inch baking sheet
  • large mixing bowl
  • pastry brush
  • sharp knife
  • work surface or cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.