CookSnap is in beta — Get it free on TestFlight →
Back to recipes

20-Min Apple Strudel with Crispy Filo

Buttery crispy filo wrapped around cinnamon-sugar apples, ready in 20 minutes. A TikTok-easy take on Austrian strudel—no yeasted dough required.

Total time
20 min
Servings
4
Calories
185
Protein
2g
20-Min Apple Strudel with Crispy Filo
comfortsimpleaustrianvegetariancrispyflakytenderweeknight

Ingredients

  • 6 sheets filo sheets
  • 4 tbsp butter, melted
  • 3 medium apples, peeled and sliced thin
  • 3 tbsp granulated sugar
  • ½ tsp ground cinnamon
  • 2 tbsp panko breadcrumbs

Instructions

  1. 1

    Heat oven to 400°F. Line a sheet pan with parchment paper.

  2. 2

    Toss apple slices with sugar and cinnamon in a bowl until evenly coated.

  3. 3

    Lay one filo sheet on a clean surface and brush lightly with melted butter.

  4. 4

    Sprinkle 1 tsp panko on the buttered filo, then layer 2 tbsp apples in a strip down one long edge.

  5. 5

    Roll the filo tightly around the apples, tucking in the sides. Brush outside generously with butter.

  6. 6

    Repeat steps 3–5 with remaining filo and apples. Arrange seam-side down on the sheet pan.

  7. 7

    Bake until filo is golden brown and crispy, 12–14 minutes. Cool 2 minutes before serving.

Tools you’ll need

  • sheet pan
  • parchment paper
  • mixing bowl
  • pastry brush
  • vegetable peeler
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.