Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Apple Strudel with Crispy Filo

Buttery crispy filo wrapped around cinnamon-sugar apples, ready in 20 minutes. A TikTok-easy take on Austrian strudel—no yeasted dough required.

Total time
20 min
Servings
4
Calories
185
Protein
2g
20-Min Apple Strudel with Crispy Filo
comfortsimpleaustrianvegetariancrispyflakytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oven to 400°F. Line a sheet pan with parchment paper.

  2. Step 2

    Toss apple slices with sugar and cinnamon in a bowl until evenly coated.

  3. Step 3

    Lay one filo sheet on a clean surface and brush lightly with melted butter.

  4. Step 4

    Sprinkle 1 tsp panko on the buttered filo, then layer 2 tbsp apples in a strip down one long edge.

  5. Step 5

    Roll the filo tightly around the apples, tucking in the sides. Brush outside generously with butter.

  6. Step 6

    Repeat steps 3–5 with remaining filo and apples. Arrange seam-side down on the sheet pan.

  7. Step 7

    Bake until filo is golden brown and crispy, 12–14 minutes. Cool 2 minutes before serving.

Tools you’ll need

  • sheet pan
  • parchment paper
  • mixing bowl
  • pastry brush
  • vegetable peeler
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.