Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Chholar Dal with Fried Mantou

Bengali chickpea curry with creamy coconut and ginger, served warm with crispy fried buns. A comfort-food classic that feels fancy but takes just 20 minutes.

Total time
20 min
Servings
2
Calories
312
Protein
11g
Chholar Dal with Fried Mantou
comfortcozyindianvegetarianchickpeascreamytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tbsp oil in a skillet over medium-high. Fry mantou buns 90 seconds per side until golden and crispy; set aside.

  2. Step 2

    In the same skillet, add remaining oil. Stir in ginger and chili for 30 seconds until fragrant.

  3. Step 3

    Add chickpeas and coconut milk; stir to combine. Simmer 8–10 minutes until the sauce thickens slightly.

  4. Step 4

    Season with salt and pepper to taste. The curry should be creamy and golden.

  5. Step 5

    Spoon chholar dal into bowls. Serve warm with crispy mantou buns on the side for dipping.

Tools you’ll need

  • large skillet
  • wooden spoon
  • bowl for serving

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.