Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

25-Min Creamy Veggie Korma

Tender mixed vegetables in a silky coconut-yogurt sauce spiked with curry spices. Ready in 20 minutes, served over steamed rice for a weeknight Indian dinner that tastes like you simmered it for hours.

Total time
25 min
Servings
4
Calories
245
Protein
7g
25-Min Creamy Veggie Korma
comfortcozyindianvegetarianvegetariancreamytenderweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tbsp oil in a large skillet over medium heat. Add diced onion and cook until soft and translucent, about 4 minutes.

  2. Step 2

    Stir in ginger-garlic paste and tomato paste until fragrant, about 60 seconds.

  3. Step 3

    Add curry powder and stir constantly for 30 seconds to bloom the spices.

  4. Step 4

    Pour in coconut milk and stir well. Add frozen vegetables and bring to a gentle simmer.

  5. Step 5

    Simmer uncovered until vegetables are tender, about 8 minutes. Stir in yogurt off the heat.

  6. Step 6

    Taste and adjust salt and pepper. Serve over steamed rice.

Tools you’ll need

  • large skillet (10–12 inch)
  • wooden spoon
  • measuring spoons
  • measuring cups

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.