Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Chholar Dal with Coconut

Silky split chickpea dal infused with coconut milk, ginger, and warm spices. A Bengali comfort classic ready in 20 minutes on the stovetop.

Total time
20 min
Servings
4
Calories
280
Protein
12g
20-Min Chholar Dal with Coconut
comfortcozyindianvegetarianveganchickpeascreamysmooth

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp oil in a medium pot over medium. Add mustard seeds; once they pop (30 seconds), add ginger and green chili.

  2. Step 2

    Stir in the rinsed dal and turmeric. Toast for 1 minute until fragrant, stirring constantly.

  3. Step 3

    Pour in coconut milk and 1.5 cups water. Bring to a boil, then reduce heat to medium-low and simmer uncovered for 12-15 minutes.

  4. Step 4

    Stir occasionally. Dal is ready when split chickpeas are completely soft and creamy, breaking apart when pressed.

  5. Step 5

    Taste and season with salt and a pinch more turmeric if desired. Add water if too thick.

  6. Step 6

    Serve hot in bowls, drizzled with a touch of oil and a pinch of red pepper flakes if desired.

Tools you’ll need

  • medium saucepan with lid
  • wooden spoon
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.