Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Chicken Alla Romana

Tender pan-seared chicken thighs with crispy edges, finished in a bright lemon-white wine sauce with tomatoes and fresh herbs. One skillet, weeknight-easy, and ready in 20 minutes.

Total time
20 min
Servings
4
Calories
385
Protein
38g
Chicken Alla Romana
freshsimpleitalianchickencrispytenderjuicyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat chicken thighs dry with paper towels. Season generously with salt and pepper on both sides.

  2. Step 2

    Heat olive oil in a large skillet over medium-high. Once shimmering, lay chicken skin-side down without moving it.

  3. Step 3

    Sear skin-side down 6 minutes until golden and crispy. Flip and cook 4 minutes more until cooked through.

  4. Step 4

    Push chicken to the side. Add garlic to the empty space and cook 30 seconds until fragrant.

  5. Step 5

    Pour in wine and lemon juice, scraping up any browned bits from the pan. Add tomatoes and stir gently.

  6. Step 6

    Simmer 3 minutes until tomatoes soften and sauce reduces slightly. Stir in lemon zest and parsley. Serve hot.

Tools you’ll need

  • 12-inch skillet with lid or cover
  • paper towels
  • wooden spoon or silicone spatula
  • microplane or zester
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.