Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Lemony Greek Chicken Thighs with Arugula

Pan-seared chicken thighs with lemon and garlic, served over peppery arugula and cherry tomatoes with crumbled feta. Ready in 25 minutes and tastes like a Greek taverna.

Total time
25 min
Servings
2
Calories
420
Protein
38g
Lemony Greek Chicken Thighs with Arugula
freshsimplegreekchickencrispytenderjuicyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat chicken dry and season generously with salt and black pepper on both sides.

  2. Step 2

    Heat oil in a large skillet over medium-high until shimmering, about 90 seconds.

  3. Step 3

    Sear chicken skin-side down for 6 minutes without moving until skin is golden and crispy.

  4. Step 4

    Flip chicken, add minced garlic, then cook 5 minutes until internal temp hits 165°F.

  5. Step 5

    Squeeze lemon over chicken and remove from heat.

  6. Step 6

    Toss arugula with cherry tomatoes and a pinch of salt, top with chicken and feta.

Tools you’ll need

  • large skillet (12-inch)
  • cutting board
  • meat thermometer

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.