Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Lemon Chicken

Bright, citrusy Chinese-style chicken with a glossy lemon sauce, ready in under 30 minutes. Pan-fried chicken thighs deliver tender meat and crispy edges that soak up the tangy glaze.

Total time
25 min
Servings
2
Calories
385
Protein
34g
Lemon Chicken
freshsimplechinesechickencrispytenderjuicyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the chicken thighs dry with paper towels by pressing gently all over, removing any surface moisture so they will brown better.

  2. Step 2

    In a small bowl, whisk together the lemon juice, soy sauce, sugar, minced garlic, and minced ginger until the sugar dissolves completely.

  3. Step 3

    Heat 2 tablespoons of olive oil in a large skillet over medium-high heat until it shimmers and slides quickly when you tilt the pan, about 90 seconds.

  4. Step 4

    Place the chicken thighs skin-side down in the hot oil; you should hear a vigorous sizzle as they hit the pan.

  5. Step 5

    Let the chicken cook skin-side down without moving it for 7 minutes until the skin is golden-brown and the meat releases easily when you lift the edge with a fork.

  6. Step 6

    Flip each chicken thigh over using tongs, placing it flesh-side down in the same skillet.

  7. Step 7

    Cook for another 5 minutes until the flesh side is opaque and no longer pink when you cut into the thickest part near the thigh bone.

  8. Step 8

    Pour the lemon sauce mixture over the chicken in the skillet, being careful to pour around—not directly onto—the skin to keep it crispy.

  9. Step 9

    Reduce heat to medium-low and simmer uncovered for 3 minutes, tilting the pan occasionally so the sauce pools under and around the chicken.

  10. Step 10

    Transfer the chicken thighs to a serving plate skin-side up, then pour the remaining sauce from the skillet over the top.

Tools you’ll need

  • 12-inch skillet or large frying pan
  • paper towels
  • small bowl
  • whisk
  • kitchen tongs
  • fork
  • measuring spoons
  • measuring cup

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.