Custrd is out on the App Store — Download it free →
Back to recipes

Chicken In Cream Sauce

Tender chicken pieces and crisp-tender broccoli and carrots are enveloped in a rich, creamy sauce, finished with a pat of herb butter for extra flavor.

Total time
30 min
Servings
4
Calories
480
Protein
38g
Chicken In Cream Sauce
comfortingheartyAmericangluten-freechickentendercreamyweeknight dinner

Ingredients

10 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Season chicken with salt and pepper; heat oil in a large skillet over medium-high.

  2. Step 2

    Sear chicken until golden and cooked through, about 5-7 minutes per side; remove and set aside.

  3. Step 3

    In same skillet, sauté garlic for 30 seconds, then add broccoli and carrots; cook 3-4 minutes.

  4. Step 4

    Pour in broth and cream; bring to a simmer and cook until vegetables are tender, about 5 minutes.

  5. Step 5

    Return chicken to skillet; simmer 2 minutes to combine flavors.

  6. Step 6

    Top with herb butter and stir until melted; serve hot.

Tools you’ll need

  • large skillet
  • spatula
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.