Custrd is out on the App Store — Download it free →
Back to recipes

Stuffed Chicken Roulade

A quick and elegant chicken breast rolled with a colorful vegetable filling, served over a smooth yellow puree with a light orange sauce. Perfect for a speedy weeknight dinner that feels special.

Total time
25 min
Servings
2
Calories
450
Protein
35g
Stuffed Chicken Roulade
comfortingweeknightAmericangluten-freechickentendercreamyweeknight dinner

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice the 2 chicken breasts horizontally to open like a book, then pound to an even 1/2-inch thickness. Season both sides with salt and pepper.

  2. Step 2

    Blanch the 1 cup green beans and 1 medium carrot (cut into thin strips) in boiling water for 2 minutes, then drain. Lay the vegetables over the chicken, roll up tightly, and secure with toothpicks.

  3. Step 3

    In a skillet over medium-high heat, melt 1 tbsp butter and sear the roulades until golden on all sides, about 5 minutes. Add the 1/2 cup orange juice, reduce heat to low, cover, and simmer until chicken is cooked through, about 10 minutes.

  4. Step 4

    Meanwhile, boil the 2 medium potatoes until tender, about 15 minutes. Drain, mash with the remaining 1 tbsp butter and a splash of water, and season with salt.

  5. Step 5

    Slice the roulades, serve over the mashed potatoes, and spoon the pan sauce over the top.

Tools you’ll need

  • skillet
  • pot
  • knife
  • cutting board
  • toothpicks

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.