Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Chicken Liver Crostini with Sweet Chili

Crispy toasted bread topped with a quick pan-seared chicken liver spread and a drizzle of sweet chili sauce. Restaurant-quality Italian appetizer that tastes like you spent hours but takes 20 minutes.

Total time
20 min
Servings
4
Calories
285
Protein
14g
Chicken Liver Crostini with Sweet Chili
elegantquickitalianchickencrispycreamyweeknightappetizer

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice baguette on a sharp diagonal into 1/4-inch-thick pieces. Lay them flat on a sheet pan and toast under the broiler until golden, 2–3 minutes per side.

  2. Step 2

    Pat chicken livers dry with paper towels. Season generously with salt and black pepper.

  3. Step 3

    Heat butter in a large skillet over medium-high until it foams. Add shallot and cook until fragrant, 60 seconds.

  4. Step 4

    Add chicken livers and sear without stirring for 2 minutes. Flip and cook 90 seconds more — center should be barely pink.

  5. Step 5

    Pour white wine into the skillet and scrape up browned bits. Simmer 30 seconds, then remove from heat and stir in thyme.

  6. Step 6

    Mash livers and pan juices with a fork until spreadable but still chunky. Spoon onto toasted bread and drizzle with sweet chili sauce.

Tools you’ll need

  • sheet pan
  • broiler or oven
  • paper towels
  • large skillet (12-inch)
  • fork or small wooden spoon
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.